PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G1981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 264aa    MW: 28529.1 Da    PI: 8.3453
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G1981genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-173176147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++ Ede l ++v+ +G+++W++I++ ++ gR++k+c++rw + 
      Gh_D05G1981 31 KGPWSPGEDEALQRLVHTYGPKNWSLISKSIP-GRSGKSCRLRWCNQ 76
                     79******************************.***********985 PP

2Myb_DNA-binding36.21.4e-1185117337
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtl 37 
                      ++T+eEd+ +++a++q+G++ W+ Iar ++ gRt+
      Gh_D05G1981  85 PFTPEEDDTIIQAHAQFGNK-WAIIARLLN-GRTP 117
                      89******************.*********.***7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.9172681IPR017930Myb domain
SuperFamilySSF466896.74E-2828118IPR009057Homeodomain-like
SMARTSM007179.5E-163079IPR001005SANT/Myb domain
PfamPF002493.1E-173176IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-253290IPR009057Homeodomain-like
CDDcd001671.84E-153375No hitNo description
PROSITE profilePS512949.76782126IPR017930Myb domain
SMARTSM007170.01782121IPR001005SANT/Myb domain
PfamPF002491.1E-985117IPR001005SANT/Myb domain
CDDcd001671.05E-785117No hitNo description
Gene3DG3DSA:1.10.10.601.3E-1291117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MPGHNSQVTT TTSTSHTSPL PIYVKDLDRI KGPWSPGEDE ALQRLVHTYG PKNWSLISKS  60
IPGRSGKSCR LRWCNQLSPE VQHRPFTPEE DDTIIQAHAQ FGNKWAIIAR LLNGRTPIKR  120
SASLGAANNV SGPCLNLGTP SGSDLSDSSL PAASPGYRPL ARTGSSKHVE TASSTTNPPT  180
ILSLSLPGFD PCENSDSGPR SDPIPSPTQV PVTTVTGHPT AGLVVGMQNG ELGMEKQFFS  240
NEFLTVIQEM IKTEVRNYMF GKFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-2930116389MYB PROTO-ONCOGENE PROTEIN
1h88_C9e-29301166143MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-29301166143MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-2930116389C-Myb DNA-Binding Domain
1msf_C2e-2930116389C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446268.11e-165PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW13e-68MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D2URN51e-174A0A0D2URN5_G
STRINGPOPTR_0002s12410.12e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.13e-61myb domain protein r1